PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462874329
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 246aa    MW: 27619.8 Da    PI: 10.7192
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462874329genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-174286348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+ Ed +l+d vk +G ++Wk Iar+++ gR +kqc++rw ++l
        462874329 42 PWTKAEDSILKDMVKHHGVHNWKVIARYLP-GRVGKQCRERWINHL 86
                     8*****************************.************996 PP

2Myb_DNA-binding42.71.3e-1395133343
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                       WT+++d+ l++a+  +G++ W+ Ia +++ gR+++ +k++
        462874329  95 FWTEDDDKMLIEAHIYHGNR-WSVIAGHLP-GRSENAIKNH 133
                      5*******************.*********.*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.8783590IPR017930Myb domain
SMARTSM007171.0E-153988IPR001005SANT/Myb domain
SuperFamilySSF466892.62E-2940133IPR009057Homeodomain-like
PfamPF002492.0E-154186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-224288IPR009057Homeodomain-like
CDDcd001671.30E-164286No hitNo description
Gene3DG3DSA:1.10.10.601.6E-1689138IPR009057Homeodomain-like
PROSITE profilePS5129413.33391142IPR017930Myb domain
SMARTSM007171.2E-992140IPR001005SANT/Myb domain
PfamPF002491.7E-1196133IPR001005SANT/Myb domain
CDDcd001672.68E-1096133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MPSRALGVTD ISVVSGIPNK LMTAWQSQIG CYGKPPAPLK APWTKAEDSI LKDMVKHHGV  60
HNWKVIARYL PGRVGKQCRE RWINHLRPDI KQSDFWTEDD DKMLIEAHIY HGNRWSVIAG  120
HLPGRSENAI KNHRNATLRS LKAKRRQKKK KSEQTPPGRF SILESYIRSI YQLNDAVPAA  180
PPPSSASPPH NLLRNPVVHI PTSSVPTNLE MSFHASNSVV GLSNPRMINL NMLPPPDMNA  240
VNDPRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-35361393105B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.11e-70PREDICTED: uncharacterized protein LOC101784221
SwissprotQ9S7L23e-37MYB98_ARATH; Transcription factor MYB98
TrEMBLK3XS581e-70K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m3e-70(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.13e-38myb domain protein 115